Hap edhe ti nje llogari ne kete webfaqe dhe jep kontributin tend
Merse erdhet ne Forumin tone!!! Ju urojme t'ja kaloni sa me mire!!!

Display results as :

Rechercher Advanced Search


Si ju duket forumi?

48% 48% [ 263 ]
13% 13% [ 72 ]
9% 9% [ 51 ]
6% 6% [ 31 ]
5% 5% [ 29 ]
18% 18% [ 98 ]

Totali i votave : 544

You are not connected. Please login or register

Disa kuriozitete

Shiko temėn e mėparshme Shiko temėn pasuese Shko poshtė  Mesazh [Faqja 1 e 1]

1 Disa kuriozitete prej 11.09.08 10:34

Novobėrda ėshtė quajtur Mali I Argjentit e mė vonė Kodra e Re e cila ra nėn sundimin osman mė 1455.

Maja e Korabit ėshtė maja mė e lartė nė Shqipėri.

Romani I parė shqiptar ėshtė “Marcja” I Ndoc Nikajt I botuar nė vitin 1899.

vitin 1530 Prishtina kishte 12 lagje, prej tyre 9 tė krishtera katolike
shqiptare dhe vetem 3 muslimane. Sot ėshtė qyteti mė I madh nė Kosovė,
pėrkatėsisht kryeqytet.

Piktori venecian Marco Basaiti qė pikturoi rreth viteve 1500-1530, ka qenė me prejardhje shqiptare.

Nė qytetin e Amalfit nė Kampani nė kishėn kryesore tė kėtij qyteti, nė vitin
1506 ngritet pėrmendorja e varrit tė perbashkėt tė familjės sė Skėnderbeut me njė shqiponjė dykrenare shqiptare.

Katund quhen disa fshatėra nė Dalmaci. Gati nė tė gjithė qytetet e Dalmacisė nga njė rruge mban emrin “Rruga Ilire”.

Shiko profilin e anėtarit

2 Re: Disa kuriozitete prej 02.02.09 13:00


Tė domosdoshme pėr jetėn
Nga studimet mbi rruzullin tokėsor mund tė formohet lehtė njė listė mbi "ekuilibrat e elementėve tė domosdoshėm pėr jetėn". Astronomi amerikan Hjuxh Ros ka hartuar njė listė nė lidhje me pėrshtatshmėrinė e Tokės pėr jetėn duke i renditur si mė poshtė:

Forca Tėrheqėse e Tokės

Nėse do tė ishte mė e madhe, atmosfera e Tokės do tė akumulonte sasi tė mėdha amoniaku dhe metani, tė cilat do tė ishin negative pėr jetėn. Nėse do tė ishte mė e vogėl, atmosfera e Tokės do tė humbte sasira tė mėdha uji qė do ta bėnte tė pamundur jetesėn.
Largėsia nga Dielli
Nėse do tė ishte mė e madhe, planeti do tė ftohej shumė, duke krijuar efekte negative mbi qarkullimin e ujit nė atmosferė, si pasojė planeti do tė hynte nė epokėn e akullit.
Nėse do tė ishte mė e vogėl, planeti do tė skuqej nga rrezet e Diellit duke shkaktuar efekte negative mbi qarkullimin e ujit nė atmosferė, gjė qė do ta bėnte tė pamundur jetesėn nė tė.
Trashėsia e Kores sė Tokės
Nėse do tė ishte mė e madhe, do tė transportohej nga atmosfera pėr nė koren e Tokės mė tepėr oksigjen.
Nėse do tė ishte mė e vogėl, do tė kishte aq lėvizje vullkanike sa do ta bėnin tė pamundur jetesėn nė planet.
Shpejtėsia e Rrotullimit tė Tokės rreth vetes
Nėse do tė ishte mė e madhe, erėrat atmosferike do tė fitonin shpejtėsi tė mėdha, tufanet dhe ciklonet do ta bėnin tė pamundur jetesėn. Nėse do tė ishte mė e vogėl, ndryshimi i temperaturės midis ditės dhe natės do tė ishte shumė i madh.
Forca Tėrheqėse midis Hėnės
Nėse do tė ishte mė e madhe, forca tėrheqėse e fuqishme e Hėnės do tė ndihej shumė efektive mbi kushtet atmosferike, rrotullimin e Tokės rreth vetes dhe mbi baticat e zbaticat nė dete. Nėse do tė ishte mė e vogėl, do tė shkaktonte ndryshime negative tė klimės pėr jetėn.
Fusha Magnetike e Tokės
Nėse do tė ishte mė e madhe, do tė formoheshin furtuna tė fuqishme elektromagnetike. Nėse do tė ishte mė e vogėl, do tė hiqej ajo mburojė e Tokės kundrejt erėrave tė Diellit dhe rrezatimit tė dėmshėm tė tij.
Albedo (Rrezet e Diellit qė reflektojnė nė sipėrfaqe tė Tokės, pėrqindja e
rrezeve tė Diellit qė arrijnė deri nė sipėrfaqe tė Tokės)

Nėse do tė ishin mė tė mėdha, me njė shpejtėsi tė rrufeshme do tė hynim nė epokėn e akullit. Nėse do tė ishin mė e vogėl, pasojat "serė" do ta rrisnin shumė nxehtėsinė ku Toka fillimisht do tė mbetej poshtė ujit nga shkrirja e akullnajave dhe mė pas do tė nxehej tej mase.
Pėrqindja e Oksigjenit dhe e Azotit nė Atmosferė
Nėse do tė ishte mė e madhe, funksionet jetėsore do tė shpejtėsoheshin negativisht. Nėse do tė ishte mė e vogėl, funksionet jetėsore do tė ngadalėsoheshin negativisht.
Pėrqindja e Ujit dhe Dioksidit tė Karbonit nė Atmosferė
Nėse do tė ishte mė e madhe, atmosfera do tė ngrohej tej mase. Nėse do tė ishte mė e vogėl, temperatura atmosferike do tė ulej.
Trashėsia e Shtresės sė Ozonit
Nėse do tė ishte mė e madhe, temperatura nė rruzullin tokėsor do tė ulej. Nėse do tė ishte mė e vogėl, rruzulli tokėsor do tė nxehej shumė dhe do tė mbetej i pambrojtur pėrballė rrezeve tė dėmshme ultravjollcė tė Diellit.
Lėvizjet Sizmike (Tėrmetet)
Nėse do tė ishin mė tė mėdha, do tė ishte njė shkatėrrim i vazhdueshėm pėr gjallesat. Nėse do tė ishin mė tė vogla, lėndėt ushqimore nė fund tė oqeanit nuk do tė pėrziheshin nė ujė, gjė qė do tė ndikonte negativisht nė jetėn nė oqeane dhe dete, si rrjedhojė edhe nė tė gjitha gjallesat e Tokės. Kėto qė numėruam deri kėtu janė vetėm njė pjesė e atyre ekuilibrave aq
delikatė dhe tė domosdoshėm pėr tė formuar dhe mundėsuar jetėn nė Tokė.Madje vetėm kėto qė u radhitėn kėtu do tė mjaftonin pėr tė demostruar se universi dhe Toka kurrė nuk mund tė arrijnė tė formohen si fryt i rastėsisė dhe i zhvillimit tė ngjarjeve aksidentale njėra pas tjetrės. Tė gjithė kėto informacione kanė cilėsinė tė konfirmojnė edhe njė herė njė fakt tė qartė. Ai, qė ka krijuar nė mėnyrė tė pėrsosur tė gjithė universin, yjet, planetet, malet dhe detet, qė i jep jetė njeriut dhe tė gjitha gjallesave, qė i mjafton fuqia tė krijojė ēdo gjė nga mosekzistenca, qė krijimet e Tij i vė nėn urdhrat e njeriut e qė zotėron njė forcė dhe fuqi tė pafund, ėshtė Allahu. Allahu, kėtė krijim tė Tijin tė pėrsosur njė ajet tė Kuranit e tregon si mė poshtė:
"A ėshtė mė i rėndė krijimi juaj apo ai i qiellit? E Ai e ngriti atė! Ngriti kurorėn e tij dhe e pėrsosi atė. Natėn ia errėsoi e ditėn ia ndriēoi. E pastaj tokėn e sheshoi. Dhe prej saj nxorri ujin e saj dhe kullotat e saj. Kurse kodrat ia pėrforcoi. Si furnizim pėr ju dhe pėr kafshėt tuaja." (Naziat, 27-33)

Harun Jahja

Shiko profilin e anėtarit http://dibra.bigforumonline.com

3 Re: Disa kuriozitete prej 02.02.09 13:01


mė i moēem nė botė nė historin e shkruar tė njerzimit ka qenė zonja
Zhane Luisa Kalmenti (Jeanne Louise Calment) e lindur mė 21 shkurt 1875
nė Francė e cila vdiq mė 4 gusht 1997.

Ajo nė jeten e saj ėshė
regjistruar nė librin e rekordeve pėr disa dukuri sikur qė ėshtė
kėngėtarja mė e vjetėr apo aktorja mė e vjetėr. Nė moshėn 114 vjeēare
ajo luajti rolin qė prezentonte vetėveten nė filmin "Vincenti dhe Unė"
(Vincent and Me) nė vitin 1990
-Krung-thep-maha-nakorn apo Krungthepmahanakornamornratanakosinma-hintarayutthayamahadilokphopnopparatraja-thaniburiromudomrajaniwesmahasatharnamo-rnphimarnavatarnsathitsakkattiyavisanukamprasit
ėshtė emri zyrtar i Bankokut kryeqytetit tė Tailandės. Njėherit ky ėshtė toponimi mė i gjatė pėr ndonjė vend gjeografik.
i toponimit pėrbėhet nga 175 shkronja dhe nga shqiptarėt ėshė vėshtirė
tė lexohet ndėrsa tabela nė hymje tė qytetit duhej tė dukej
-Zsofie Gyamati ėshtė njė
19 vjeēare (2006) qė pėr librin e rekordeve pohon se ja pasur orėn e
mėsimit mė tė gjatė nė botė. Ajo thotė se ishte ora e mėsimit tė
gramatikės dhe literaturės sė hunarishtes.
Kjo ndodhi si ide e
njėrit nga sholkėt e klasės pasi qė tė Mėrkuren kishin dy orė tė gjata
njėren pastjetres. Pasi qė atyre ju nevojitej tė ndiqnin dy leksionet
njėri pas tjetrit, idea e shokut tė saj ishte qė tė studionin pandėrpre
24 orė. Kėshtu ai aranzhoi kėtė orė mėsimi nė gjimnazė.
e kėsaj ore mėsimi ishin qė brenda 24 orėve tė mos ketė ndėrpreje
bisede, asnjėri tė mos e zinte gjumi dhe nevoja biologjike duhej kryer
brenda dy minutave. Kėto tri rregulla kanė qenė njėherit edhe "njėsi
matėse" qė duhej rrespektuar gjithsesi.

Shiko profilin e anėtarit http://dibra.bigforumonline.com

4 Kuriozitete prej 02.02.09 14:19


Ne 1 kg limon ka me tepėr sheqer se ne 1 kg luleshtrydhe.
Shteti me me tepėr rruge te asfaltuara ėshtė Franca.
Ajnshtajni deri ne moshen 9-vjeēare nuk fliste normalisht.
Nje shqiponje mund ta shohe prene e saj qe 3000 metra larg.
Kuajt mund te qendrojne deri ne 1 muaj ne kembe.
Nuk mund te teshtish pa i mbyllur syte.
Fluturat shijojne me ane te kembeve.
Delfinet flene me nje sy hapur.
Nje njeri qesh mesatarisht 13 here ne dite.
Minjte mund te durojne pa uje me tepėr se devete.
Ne trupin e njeriut muskuli me i forte ėshtė gjuha.
Pavaresiht nga madhesia dhe trashesia nje flete nuk mund te paloset me tepėr se 9 here.
Femrat i perpelisin syte 2 here me shume se meshkujt.
Nje ari i rritur mund te vrapoje po aq shpejt sa nje kale.
Nėse damarėt e njeriut do tė vendoseshin njeri pas tjetrit do tė mund tė pėrshkronin Ekuatorin 2 herė.
Nė fytyrėn e njė maceje ndodhen 146 muskuj.
Nė vendet e zhvilluara % e te rritureve qe martohen ra nga 72% ne 1970 nė 60 % ne 1996. Mundėsia pėr divorcim nė martesėn e parė u rrit nga 50% nė 67%. Mundėsia pėr divorcim nė martesėn e dytė ėshtė rreth 10 % me e lartė se nė martesėn e parė.
Nė Zelandėn e Re ka 4 milionė njerėz dhe 70 milionė dele.
DNA ka njė madhėsi prej 1 tė mijtat e milimetrit, pėrbehet prej rreth 200 miliard atomesh dhe pėrmban 1 milion faqe njohuri.
Nėse do tė mund tė pėrdornim 13% tė trurit, do tė mund tė shfaqeshim nga njė vend nė njė tjetėr.
Nė Ditėn e Nėnave nė SHBA bėhen mė tepėr telefonata personale se nė
ēdo ditė tjetėr nė ēdo shtet tjetėr.
Megjithėse nė botė ka mė shumė se 600 milionėtelefona, gjysma e botės
ende nuk ka bėrė asnjė telefonatė.
Gjysma e popullsisė sė botės fiton vetėm rreth 5% tė pasurisė sė botės.
Nė 1750 nė botė jetonin rreth 800 milionė njerėz, nė1850 nje miliardė mė tepėr dhe nė njė 1950 edhe njėtjetėr miliard mė tepėr. Pastaj u deshėn vetėm 50 vjet pėr tu dyfishuar dmth. 6 miliardė.
Mbi vezen:
Nė Romėn e lashte veza gjendej vetėm nė tavolinat mė tė rėndėsishme dhe ruhej vetėm pėr miqtė mė tė rėndėsishėm.
Nė Egjypt veza konsiderohej njė privilegj dhe monopol i faraonėve, sacėrdotėve dhe shtresave tė larta tė shoqėrisė.
Qytetėrimet antike, egjiptianėt, persianėt, grekėt e romakėt, e kanė kuptuar mjaft mirė se veza e pulės ėshtė burim energjie dhe vlerash tė papėrsėritshme ushqimore.
Nė botė veza konsiderohet si ushqimi qė ka furnizuar pėr shekuj me radhė proteinėn mė tė mirė me origjinė shtazore dhe si ushqimin qė ka shpėtuar popuj tė tėrė nga rreziku i tė mosushqyerit ose tė ushqyerit tė keq.
Sherbimi Postar i SHBA dėrgon rreth 43% tė postės botėrore, ndjekėsi mė i afėrt ėshtė Japonia me 6 %.
Nė Perėndim njerėzit ndėrrojnė shtepi mesatarisht 1 herė nė 7 vjet.
Mjalti mund tė qėndrojė pa u prishur 3000 vjet dhe pėr kėtė arsye dylli i mjaltit pėrdoret pėr procesin e mumezimit.
Peshkaqenėt nuk sėmuren.
Hyrja e folesė sė milingonės drejtohet pėrherė nga Veriu.
Krokodili, ėshtė ajo lloj kafshe, qe vazhdon e zgjatet deri ne diten e fundit te jetes.
Krokodili me gjatesine rekord, ėshtė gjetur ne Amerike, dhe ishte i gjate 7,2 metra.
Biblioteka me e madhe ne bote, gjendet ne Kryeqytetin amerikan, Washington. Kjo biblioteke u ndertua me 24 Prill 1800. Ne te gjenden 107 milione shkrime te te gjitha llojeve.
Poezia me e gjate ne bote,u perfundua mbas 30 vitesh pune, nga Shkrimtari Jose“ Rumanzo nga Ekuadori. Mrekullia e tij "Perusia" ne te cilen ai shqyrton fundin e botes,perbehej nga 7 Vellime, me 5000 faqe gjithsej, dhe nga 230 000 rreshta. Pas tij vjen, Komediani Dante Aligheri, me Komedine Hyjnore. Afersisht 30 000 reshta.
Mbajtes rekordi pėr derrin me te dhjamosur ne histori,mbahet nga amerikani Eber Big Boy,i cili jetonte ne shtetin Carolina. Ai peshonte 863,6 kg dhe arriti te ēudiste me kete peshe ekspertet para peshores.
Mbiemri me i shpeshte ne bote ne rangun internacional..eshte mbiemri Chang.Rreth 75 milione njerez ne Kine,kane kete mbiemer.
Vendin e dyte,pėr mbiemrin me te perdorshem e ka,mbiemri Smith,ne Angli.Rreth 800 000 veta e kane kete mbiemer. Vendin e trete e ze mbiemri Müller,ku 10 % e popullsise quhet me kete mbiemer.

Trimmatom nanus ėshtė peshku mė i vogel nė botė me gjatsi 8.6 mm (mashkulli) dhe 8.9 mm (femra).
Tuneli mė i madh nėn det ėshtė ai i Sekanit nė Japoni me gjatėsi 53850m.
Aeroporti mė i madh i botės ėshtė CHEK LAP KOK nė Hong Kong me sipėrfaqe 1248 ha.
Temperatura mė e lartė e regjistruar nė botė ėshtė 57,5 gradė nė Elaziz tė Libisė (Afrikė), kurse mė e ulta u regjistrua nė stacionin Vostok Antarktidė -89,6 gradė.
Ndėrtesa mė e lartė prej 558 metrave ėshtė duke u ndėrtuar nė Xhakarta tė Indonezisė.
Brenda dites bėhen rreth 45000 fluturime ajrore duke transportuar mbi 3,5 milionė udhėtarė.
Nėse do tė mblidhej gjatėsia e hapave qė bėhen nga njerėzit nė 24 orė, kjo largėsi do tė ishte e barabartė me 88 vajtje ardhje tokė-diell.
ELEFANTI AFRIKAN - Me gjithė peshėn e tij tė rėndė mund tė vrapojė me shpejtėsi rreth 40 km/h duke ia kaluar edhe njeriut.
RACA - Nė botė raca e bardhė pėrfshin 46% tė popullsisė sė pėrgjithshme botėrore, raca e verdhė 36%, raca e zezė 6% dhe racat e pėrziera 12%.
PALOS - Eshtė liman spanjoll (port) prej ku u nis Kristofor Kolombi (nė pranveren e vitit 1492) pėr nė Indi, nė tė vėrtetė ai kishte mbėrritur nė Amerikė. Dhe kėshtu ai sot konsiderohet si zbulues i Amerikės.
ĒDO DITE - Nė botė kontrollohen rreth 3 milionė pasaporta udhėtarėsh, qė po tė vendosen njėra mbi tjetrėn do tė arrijnė njė lartėsi me mijėra kilometra.
EPIDEMITE - "Murtaja e zezė" nė Evropė dhe Azi mė 1347-51 shkaktoi rreth 75 milion tė vdekur, gripi mė 1918-20 nė gjithė botėn shkaktoi mbi 21 milion tė vdekur.
FLUTURA - Mė e madhe nė botė ėshtė ajo e Braziliane Erebius Agripina qė ka gjatėsi tė krahėve tė hapura 20-25 cm.
KOSOVA - Me sipėrfaqe prej 10897 km2 zotėron njė potencial mineral tė tillė qė tė krahasohet me provincat mė tė pėrmendura nė Evropė si Ruhri, Silezio, Sudeto etj.
TITANIKU - Eshtė anija qė konsiderohet si anija e parė gjigante nė botė. Kapaciteti ka qenė 46000 ton me gjatėsi 268 m dhe lartėsi 53 m. Mund tė udhėtonin 1343 udhėtarė, ndėrsa tani si anije mė gjigante ėshtė anija Freedom e cila peshon 2,7 miljon ton, gjatėsi prej 1296 m, dhe lartėsi 105 m, ku mund tė udhėtojnė 65000 veta nė 20000 apartamente pra njė qytet i tėrė lundrues.
SHPEJTESIA E DISA KAFSHEVE - Kėrmilli lėviz me shpejtėsi prej 0,05 km/h, rreth 100 herė mė ngadal se njeriu. Breshka konsiderohet se ec ngadal por ajo arrin 0,37km/h. Macja ecėn me shpejtėsi 50 km/h. Miu arrin shpejtėsi rreth 10 km/h.
LUFTA - Mė e gjatė zgjati 115 vjet ndėrmjet Francės dhe Anglisė ndėrsa ajo mė e shkurta nė vitin 1896 ndėrmjet Britanisė dhe Zanzibarit qė zgjati vetėm 38 minuta.
Sot nė tė gjithė botėn qarkullojnė rreth 630 milion automobila dhe ēdo ditė nė botė prodhohen rreth 137.000 automjete
Virgjinia - Eshtė kolonia e parė e anglezeve nė Amerikė.
SOFISTE - Quheshin mėsuesit udhėtarė te helenet
Bomba atomike - Pėr herė tė parė, me 6 gusht ėshtė hedhur nė Hiroshima tė Japonisė, ku humbėn jetėn mė se 155200 veta. Kjo bombe kishte masėn 4080 kg.
Ekzistojne rreth 6000 semundje gjenetike dhe nga kėto vetėm pėr njė pjesė shumė e vogėl ėshtė e sherueshme aktualisht. Shpresohet qe me deshifrimin e materialit gjenetik tė arrihet te kuptohen me mirė sėmundjet,mekanizmat e tyre dhe mundesisht ndonjė kurim i mundshem.
Shteti me numrin mė tė madh tė farmacistėve ėshtė Kina, e cila nė vitin 1995 kishte tė regjistruar 418000 tė tillė. Qė prej 20000 vitesh kinezėt kurohen me mjekimet tradicionale tė pėrgatitura nga farmacistėt.
Principata e Monakos ėshtė vendi me numrin mė tė madh tė telefonave pėr frymė pasi numėron 1994 telefona pėr ēdo 1000 persona.
Mari Kyri ėshtė femra e parė qė mori ēmimin Nobel, njėkohėsisht dhe femra e vetme qė ka marrė dy ēmime Nobel, njė pėr zbulimin dhe studimin e radioaktivitetit me 1903, ndėrsa me 1911 asaj pėr herė tė dyte iu dha ēmimi Nobel nė Kimi.
Klaud Galeni mendohet si babai i farmacisė.

Shiko profilin e anėtarit http://dibra.bigforumonline.com

5 E bukur fare prej 02.02.09 14:20


Molla dhe dardha jane frutat qe nuk dihmojne fare me kujtesen dhe ju keshilloj mos i hani para provimeve.

Je shqiptar i vertete vetem kur:

1. Je kusheri me gjysmen e njerezve qe njeh.
2. Ke te pakte 10 shoke qe e kane emrin "Genti".
3. Ne martesen tende normalisht vijne 400 te ftuar.
4. Ne martesen tende njeh vetem 1/3 e te ftuarve.
5. Ne martesen tende kenga e pare ka qene "Dy dele, treqind
6. Ke bere nje xhiro me shkollen ne Kruje.
7. Jeton mes vajzash qe tentojne te shfaqin 25 vjec,
e jane vetem 15.
8. Do lesh bakshish dhe ne supermarket.
9. Ke tre pale kepuce te zeza.
10. Ke me shume alkohool ne dollapin e shtepise sesa ka bari I lagjes.
11. Je 30 vjec dhe ta rregullon krevatin mamaja.
12. Gjithe kingat/kinget e qytetit jane kusherinjte e tu.
13. Sa here qe del
ne televizor kryetari I partise opozitare me bindjet e tij, plaku jot fillon ta
shaje nga 'robt e shpise'.
14. Prindrit e tu kane vajtur me pushime vetem njehere gjate jetes se tyre, dhe kjo ne Shqiperi.
15. Ke te pakten nje te afrem me te cilin familja jote nuk flet.
16. Kur je jashte nuk do te kesh te besh me shqiptaret.
17.Prindrit e tu hedhin nje komb raki esell.
18. Xhaja jot ben nje vere qe eshte me e forte se rakia.
19. Je I bindur qe gjithcka eshte nje konspiracion kunder teje dhe vendit tend.
20. Plaku jot mendon se e ka telefonin nen pergjim.
21. Nqs je vajze, dhe nuk je martuar pas 20 vjec, je nje beqare e stazhionuar.
22. Mamaja jote e ka mbeshtetur jeten mbi leximin e filxhanit te kafese.
23. Cdo ditelindje tenden, prindrit e tu te fotografojne ndersa pret torten me
nje thike te madhe.
24. Rakia kuron cdo semundje dhe perdoret dhe per masazh.
25. Ke unaza me te medha se ato te mamase/gruas/motres.
26. Miqte e tet eti te japin raki qe gjashtemebedhjete vec.
27. Prindrit e tu e kthejne cdo kopesht nje ferme frutaperimesh, ku ka aq shume domate/qepe/speca sa per ti shuar urine gjithe lagjes.
28. Frigoriferi eshte aq plot me mish e salcice sa te mund te perballohen 10
vjet zi buke.
29. Mamaja jote thote qe nuk merret me thashetheme mbi miqte, por e di shume mire qe e ben.
30. Je ne tavoline me dy miq dhe nderkohe keni 4 ide te ndryshme politike.
31. Merr 4 ne histori dhe di permendesh
filmin Skenderbeu.
32. Gjyshja jote thote qe te pjerdhurit ben mire per shendetin.
33. Degjon prindrit qe flasin kur je akoma 100 m nga
34.Mamaja jote nuk hedh asnjehere ne plehra ate qe mbetet nga dreka, por e ha ne
darke e ne mengjesin e dites tjeter.
35. Te afremit e tu u qelbet fryma ere hudher, dhe kembengulin qe hudhra vret
36. Dhe nje muaj pas vitit te ri vazhdoni te hani bakllavane e pergatitur nga
37. Ke patjeter nje xhup lekure.
38. Gjyshja jote te ndjek per te te dhene arra me mjalte cdo here qe ke marre
te ftohte.
39. Dhe nqs je e shendoshe vesh rroba qe te rrine puthitur.
40. Prinderit e tu me zor nuk I rezistojne tundimit per te mbyllur cdo ballkon
te shtepise me verande.
41. Ke gjithmone modelin e fundit te celularit, qe del ne treg, Nganjehere dhe
ate qe akoma nuk ka dale.
42. Nuk arrin ta bindesh nene tende se tenxheret me veshe jane me te mira se
ato pa veshe.
43. Mund te rrish tre ore me nje kafe ne bar.
44. Prinderit
te tu kur flasin ne telefone me te afermit jashte Shtetit, bertasin qe te
45. Je I bindur qe te gjithe personazhet e famshem te historise e ne bote jane me origjine
46. Je I papune por ke nje benz per te levizur.
47. Nuk I ke pare me floket e gjyshes qe
kur ka vdekur gjyshi.
48. Je
njeqind kile por mamaja akoma te thote qe je I dobet.
49. Punon ne Itali si murator por kur kthehesh ne Shqiperi u thuaj te gjitheve
qe je nje biznesmen I suksesshem.
50. Kur gjyshi yt rrufiste cajin, shtepia dridhej.
51. Nuk e ben kurre sot nje pune qe mund te behet neser.
52. I konsideron taksat si nje shtypje te tmerrshme te shtetit ndaj qytetarit.
53. Blen nje makine te re ne momentin qe vendos te kthehesh per te jetuar ne
54. Je 30 vjec dhe rrobat ti lan mamaja.
55. Ke filluar te pish konjak ne kafene qe kur ke qene 12 vjec.
56. Mamaja jote te flet nqs nuk vesh kanatjeren.
57. Te kane mesuar qe jo vetem te duash te afermit e tu, por dhe kusherinjte e
13-te sikur te ishin vllezerit e tu.
58. I therret te gjithe politikanet e botes me emer.
59. Nuk je kurre I vendosur nese eshte me mire te jetosh jashte apo te kthehesh
ne Shqiperi.
60. Te gjithe te afermit meshkuj qe takon kane tre dite parruajtur, ju vjen
fryma ere hudher, dhe te lene nje kile jarge kur te puthin.
61. Ora jote eshte me e rendesishme se lumturia jote.
62. Je I varfer jashte por duhet ti besh te gjithe te besojne se je I pasur kur
kthehesh ne Shqiperi.
63. Miqte e prinderve te tu nuk I bien asnjehere drejt kur duan te te thone qe
je shendoshur, apo I ke prere floket me nje model jo te hijshem.
64. Transferohesh te jetosh me prindrit per te qene me afer, dhe perfundon duke
u zene per nje ceshtej fare pa rendesi.
65. Mban ne shtepi te fshehur nje arme zjarri.
66. Nqs Kina do te pushtonte boten do te beheshe pa medyshje budist.
67. Ke me respekt per te fortin e lagjes
sesa per Presidentin e Republikes.

Shiko profilin e anėtarit http://dibra.bigforumonline.com

6 Re: Disa kuriozitete Today at 21:21

Sponsored content

Shiko temėn e mėparshme Shiko temėn pasuese Mbrapsht nė krye  Mesazh [Faqja 1 e 1]

Drejtat e ktij Forumit:
Ju nuk mund ti pėrgjigjeni temave tė kėtij forumi